Total number of results for Metacarcinus magister are 3
Download
as Fasta All
| NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
|---|---|---|---|---|---|---|---|
| NP00699 |
RVINDDCPNLIGNRDLYKRVEWICEDCSNIFRNTGMATLCRKNCFFNEDFLWCVYATERTEEMSQLRQWVGILGAGRE
|
78 | Metacarcinus magister | Arthropod CHH/MIH/GIH/VIH hormone | Molt-inhibiting hormone | ||
| NP01223 |
TNRNFLRF
|
8 | Metacarcinus magister | FMRFamide related peptide | FMRFamide-like neuropeptide 4 | 18719922#Verley DR, Doan V, Trieu Q, Messinger DI, Birmingham JT#Characteristic differences in modulation of stomatogastric musculature by a neuropeptide in three species of Cancer crabs#J Comp Physiol A Neuroethol Sens Neural Behav Physiol 2008 Oct;194(10):879-86 | |
| NP05532 |
TPSGFLGMR
|
9 | Metacarcinus magister | Tachykinin | Tachykinin-related peptide | 17437551#Stemmler EA, Peguero B, Bruns EA, Dickinson PS, Christie AE#Identification, physiological actions, and distribution of TPSGFLGMRamide: a novel tachykinin-related peptide from the midgut and stomatogastric nervous system of Cancer crabs#J Neurochem 2007 Jun;101(5):1351-66 |